Protein coding transcript 138470

• Transcript: Ll_transcript_275124
• CDS coordinates: 912-1508 (+)
• Peptide sequence: MNRQAFSGPLTSKPMSLKSFLAGGSVGPIEVPPLASGVWTRLPMPQSSSPKASTSASPPHVSSPRVSELHELPRPPAPGNQSFKSVKSCQTGHSAPLLFRNPERPATNKFPSVVLSAASPLPTPPLVVSRSFSIPSSSQRAMALHVAKFLDTPQVPETIEEAASPPLTTASLSDIKRASSISDLGSRSSEIRVDAGGR*
• ORF Type: complete

Annotations of Ll_transcript_275124

• Blastp: Uncharacterized protein At2g33490 from Arabidopsis with 42.37% of identity
• Blastx: Uncharacterized protein At2g33490 from Arabidopsis with 34.04% of identity
• Eggnog: Hydroxyproline-rich glycoprotein family protein(ENOG410YD6T)
• Kegg: Link to kegg annotations (AT2G33490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453097.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;