Transcript | Ll_transcript_408063 |
---|---|
CDS coordinates | 83-427 (+) |
Peptide sequence | MVIPPPVRAVRIINYLKPYVLKMHFTNKYVTAQVIHTPTATVASSASSQEKALRSSLEIKRDVAAAAKIGKILAERLLLKDIPAVSVHLKREQKYHGKVKAVIDSMREAGVKLI* |
ORF Type | complete |
Blastp | 50S ribosomal protein L18 from Xanthobacter with 39.62% of identity |
---|---|
Blastx | 50S ribosomal protein L18 from Azorhizobium with 41.51% of identity |
Eggnog | This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance (By similarity)(COG0256) |
Kegg | Link to kegg annotations (Xaut_4782) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435751.1) |
Pfam | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast (PF00861.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer