Protein coding transcript 138576

• Transcript: Ll_transcript_275219
• CDS coordinates: 1068-1394 (+)
• Peptide sequence: MYFFSNRKGYVCGNSSRIVVGSGYWKSIGKDKAIVASDSRQVIGMRKTLIYSKGKHSNETKTQWVMHELCLVGSGESSYPFQVITKLKRLTIITIKLSIFSVIPFEFS*
• ORF Type: complete

Annotations of Ll_transcript_275219

• Blastp: NAC domain-containing protein 41 from Arabidopsis with 50.63% of identity
• Blastx: NAC domain-containing protein 41 from Arabidopsis with 46.94% of identity
• Eggnog: NAC domain containing protein 41(ENOG41107S8)
• Kegg: Link to kegg annotations (AT2G33480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433246.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;