Transcript | Ll_transcript_275222 |
---|---|
CDS coordinates | 1068-1538 (+) |
Peptide sequence | MYFFSNRKGYVCGNSSRIVVGSGYWKSIGKDKAIVASDSRQVIGMRKTLIYSKGKHSNETKTQWVMHELCLVGSGESSYPFQKPVADFAVYRIFQKKKKQKTKGSNGKICSSRKVEDVKPSFIDLNVEYGDDTGPPPPCSPCLSEDSEISCNYNLV* |
ORF Type | complete |
Blastp | NAC domain-containing protein 83 from Arabidopsis with 43.88% of identity |
---|---|
Blastx | NAC domain-containing protein 41 from Arabidopsis with 42.98% of identity |
Eggnog | nac domain(ENOG410YED8) |
Kegg | Link to kegg annotations (AT5G13180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433246.1) |
Pfam | No apical meristem (NAM) protein (PF02365.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer