Protein coding transcript 138599

• Transcript: Ll_transcript_275242
• CDS coordinates: 270-578 (+)
• Peptide sequence: MILKWLVFINFHSFSFNPLVQFFWVISKIVPFLLQILVVRNDLKMGKGKIAAQCSHATLGLYKKLHNRAPKALHRWEMCAQPKVVVKIESEEDMLALQVSIV*
• ORF Type: complete

Annotations of Ll_transcript_275242

• Blastp: Peptidyl-tRNA hydrolase 2, mitochondrial from Homo with 64.52% of identity
• Blastx: Peptidyl-tRNA hydrolase 2, mitochondrial from Homo with 64.52% of identity
• Eggnog: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity)(COG1990)
• Kegg: Link to kegg annotations (51651)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413692.1)
• Pfam: Peptidyl-tRNA hydrolase PTH2 (PF01981.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;