Protein coding transcript 13862

• Transcript: Ll_transcript_324460
• CDS coordinates: 2-1045 (+)
• Peptide sequence: LNVNSIHILFLLFKIEKRNKIISIHTLLLPKSRACTTYLNRFHHSLKFTFNSNSNQFHSHFNFKTMSFEVVEEEAFEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDRIWSGRIRVVSRKDRCEIRLEDPNSGDLFAACFVYPGQREVAVEPVLDSSRYFVLKVENGQGKHAFLGLGFAERNEAFDFNVALSDHDKYVRREHEKESGGGGVSSEESQIDIHPAVNHRLKEGETIRINVKHKISSGTGMLSAAGLTSGHAGTPKPKVLSLAPPPSGAGKIRSPLPPPPNDPVAARIASTSRGTGLKGTNDGERHSTDSLSDLSRLQKNLPSAASSGAATASGWAAF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_324460

• Blastp: Uncharacterized protein At1g03900 from Arabidopsis with 72.56% of identity
• Blastx: Uncharacterized protein At1g03900 from Arabidopsis with 73.15% of identity
• Eggnog: NECAP endocytosis associated(ENOG41113PS)
• Kegg: Link to kegg annotations (AT1G03900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428984.1)
• Pfam: Protein of unknown function (DUF1681) (PF07933.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;