Protein coding transcript 138644

• Transcript: Ll_transcript_3721
• CDS coordinates: 118-972 (+)
• Peptide sequence: MSSMDRILVIGATGFMGQFVTKEILNLGRPTYLLLRPGSITPSKAAIVKSFQDKGATLIHGVINDKEFMEKIMKEYNIDIVVSLVGGGNLLDQLALVEAIKSVKTIKRFLPSEFGHDVERANPVEPGLSMYKEKRLIRRMTEESGIPFTYICCNSIASWPYYDNSHPANVPPPLDQFQIYGDGNIKAYFVDGNDIGKFTMKAIDDIRTLNKIVHFRPSSNCYSINELASLWEKKIGRTIPRITISEHDLLATAAGSITNIFPLFIIKKSKYLFQFVLKFTCVPI*
• ORF Type: complete

Annotations of Ll_transcript_3721

• Blastp: Leucoanthocyanidin reductase from Desmodium with 75% of identity
• Blastx: Leucoanthocyanidin reductase from Desmodium with 75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAD79341)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454952.1)
• Pfam: NmrA-like family (PF05368.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;