Transcript | Ll_transcript_3723 |
---|---|
CDS coordinates | 237-977 (+) |
Peptide sequence | MEKIMKEYNIDIVVSLVGGGNLLDQLALVEAIKSVKTIKRFLPSEFGHDVERANPVEPGLSMYKEKRLIRRMTEESGIPFTYICCNSIASWPYYDNSHPANVPPPLDQFQIYGDGNIKAYFVDGNDIGKFTMKAIDDIRTLNKIVHFRPSSNCYSINELASLWEKKIGRTIPRITISEHDLLATAAENRIPESVVASFTHDIFIKGCQVNFNTDGPKDVEISILYPDEKFRSLEDCFEDFLPMVHQ* |
ORF Type | complete |
Blastp | Leucoanthocyanidin reductase from Desmodium with 80.82% of identity |
---|---|
Blastx | Leucoanthocyanidin reductase from Desmodium with 81.03% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAD79341) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454952.1) |
Pfam | NmrA-like family (PF05368.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer