Protein coding transcript 138660

• Transcript: Ll_transcript_3786
• CDS coordinates: 22-456 (+)
• Peptide sequence: MASAPAQIPTSFGHELRACLRCRLVKTYDQVLLPFNVSHHSLPCLLICLVTISVFVTQFRESGCENCAFFKMEEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGVYTLAVSEALPEEMQALCEDERVQYNPPKRL*
• ORF Type: complete

Annotations of Ll_transcript_3786

• Blastp: Transcription elongation factor SPT4 homolog 2 from Arabidopsis with 68.06% of identity
• Blastx: Transcription elongation factor SPT4 homolog 2 from Arabidopsis with 68.06% of identity
• Eggnog: Transcription elongation factor(COG5204)
• Kegg: Link to kegg annotations (AT5G63670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459386.1)
• Pfam: Spt4/RpoE2 zinc finger (PF06093.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;