Protein coding transcript 138668

• Transcript: Ll_transcript_3733
• CDS coordinates: 596-1291 (+)
• Peptide sequence: MFGGQEKNVEGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGQRAVYTTGKGASAVGLTAAVHKDPVTREWTLEGGALVLADKGICLIDEFDKMNDQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPVGGRYDSSKTFSQNVELTDPIISRFDILCVVKDVVDPVTDEMLAQFVVDSHFKSQPKGGNKDDKSFSEPQDASMPDDPEVTKALLFYNNHILSNLRLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_3733

• Blastp: DNA replication licensing factor MCM2 from Arabidopsis with 88.99% of identity
• Blastx: DNA replication licensing factor MCM2 from Arabidopsis with 89.14% of identity
• Eggnog: dna replication licensing factor(COG1241)
• Kegg: Link to kegg annotations (AT1G44900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456418.1)
• Pfam: MCM2/3/5 family (PF00493.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;