Protein coding transcript 138755

• Transcript: Ll_transcript_3741
• CDS coordinates: 122-1096 (+)
• Peptide sequence: MKSWKTVLLSVTSYALGLFLISKSPWYLLPFAWAWTGTAATGLFVVAHDCAHKSFSKNKLVEDIVGNVALMPLIYPYEAWRFKHDHHHAKTNMLYEDTAWHPILKEDFDSSPLMRKAIIYGYGPIRPLMSIAHWVLWHFDLKKFRTNEVKRVMISLACVFSFMAIAWPLIIYKTGIFGWINYWLMPWLGYHFWMSTFTMVHHSAPHIPFKGSDEWNAAQAQLNGTVHCNYPKWVEILCHDINVHIPHHVSSKIPSYNLRAAHNSLKENWGKYMNEATWNWRLMKTILTMCHVYDKEKNYVAFDELAPEDSGPITFLRKAMPNFA*
• ORF Type: complete

Annotations of Ll_transcript_3741

• Blastp: Omega-6 fatty acid desaturase, chloroplastic from Brassica with 77.78% of identity
• Blastx: Omega-6 fatty acid desaturase, chloroplastic from Brassica with 77.54% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416362.1)
• Pfam: Fatty acid desaturase (PF00487.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;