Protein coding transcript 138757

• Transcript: Ll_transcript_3745
• CDS coordinates: 172-807 (+)
• Peptide sequence: MRKAIIYGYGPIRPLMSIAHWVLWHFDLKKFRTNEVKRVMISLACVFSFMAIAWPLIIYKTGIFGWINYWLMPWLGYHFWMSTFTMVHHSAPHIPFKGSDEWNAAQAQLNGTVHCNYPKWVEILCHDINVHIPHHVSSKIPSYNLRAAHNSLKENWGKYMNEATWNWRLMKTILTMCHVYDKEKNYVAFDELAPEDSGPITFLRKAMPNFA*
• ORF Type: complete

Annotations of Ll_transcript_3745

• Blastp: Omega-6 fatty acid desaturase, chloroplastic from Arabidopsis with 80% of identity
• Blastx: Omega-6 fatty acid desaturase, chloroplastic from Arabidopsis with 76.27% of identity
• Eggnog: linoleoyl-CoA desaturase activity(COG3239)
• Kegg: Link to kegg annotations (AT4G30950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416362.1)
• Pfam: Fatty acid desaturase (PF00487.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;