Transcript | Ll_transcript_3746 |
---|---|
CDS coordinates | 211-606 (+) |
Peptide sequence | MSTFTMVHHSAPHIPFKGSDEWNAAQAQLNGTVHCNYPKWVEILCHDINVHIPHHVSSKIPSYNLRAAHNSLKENWGKYMNEATWNWRLMKTILTMCHVYDKEKNYVAFDELAPEDSGPITFLRKAMPNFA* |
ORF Type | complete |
Blastp | Omega-6 fatty acid desaturase, chloroplastic from Brassica with 80.92% of identity |
---|---|
Blastx | Omega-6 fatty acid desaturase, chloroplastic from Brassica with 80.92% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416362.1) |
Pfam | Fatty acid desaturase (PF00487.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer