Protein coding transcript 138768

• Transcript: Ll_transcript_3459
• CDS coordinates: 2025-2660 (+)
• Peptide sequence: MFVSYDHMKWFILFVLRNMFIFFIPNHSMDWFYFFSFAQAAAAAQAGASVIQIFVGRIRDWARNHSDDPEIESAQLRGEDPGLALVKKAYNYIHKYGHKSKLMAAAVRNKQDLFSLLGVDYIIAPLKVLQSLKESVASPDEKYSFVSRLSPQSAAKYVFSDEELVEWNQTSLTEAMGPAAVQLLASGLDGYASQANRVEELFGKIWPPPNV*
• ORF Type: complete

Annotations of Ll_transcript_3459

• Blastp: Transaldolase from Shigella with 32.56% of identity
• Blastx: Transaldolase A from Pasteurella with 40.49% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SBO_0009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446690.1)
• Pfam: Transaldolase/Fructose-6-phosphate aldolase (PF00923.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;