Protein coding transcript 138769

• Transcript: Ll_transcript_3461
• CDS coordinates: 181-1131 (+)
• Peptide sequence: MSFTLKITPSVSTPLFSSVSSSIHSTKSTFSLHSTLFFNSQIHHNPLHHLQIRASSTDTASTTELDAVSAFSHIVPDTVIFDDFQKFPPTAATVSSSLLLGICGLPDTIFRNAVEMALADSECYGLENSDTRLSCFFNKALVNVGGDMTKLVPGRVSTEVDARLAYDTHAIIRKVHDLLRLYNDINVPPQRLLFKIPATWQGIEAARLLESEGIQTHLTFVYSFAQAAAAAQAGASVIQIFVGRIRDWARNHSDDPEIESAQLRGEDPGLALVKKAYNYIHKYGHKSKLMAAAVRNKQDLFSLLGYSKASQLSYLT*
• ORF Type: complete

Annotations of Ll_transcript_3461

• Blastp: Transaldolase from Histophilus with 41.39% of identity
• Blastx: Transaldolase from Histophilus with 41.39% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (HSM_0072)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446690.1)
• Pfam: Transaldolase/Fructose-6-phosphate aldolase (PF00923.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;