Protein coding transcript 138772

• Transcript: Ll_transcript_3465
• CDS coordinates: 181-858 (+)
• Peptide sequence: MSFTLKITPSVSTPLFSSVSSSIHSTKSTFSLHSTLFFNSQIHHNPLHHLQIRASSTDTASTTELDAVSAFSHIVPDTVIFDDFQKFPPTAATVSSSLLLGICGLPDTIFRNAVEMALADSECYGLENSDTRLSCFFNKALVNVGGDMTKLVPGRVSTEVDARLAYDTHAIIRKVHDLLRLYNDINVPPQRLLFKIPATWQGIEAARLLESEGIQTHLTFVYRFS*
• ORF Type: complete

Annotations of Ll_transcript_3465

• Blastp: Transaldolase A from Pasteurella with 40.49% of identity
• Blastx: Transaldolase A from Pasteurella with 40.49% of identity
• Eggnog: Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway (By similarity)(COG0176)
• Kegg: Link to kegg annotations (PM1602)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446690.1)
• Pfam: Transaldolase/Fructose-6-phosphate aldolase (PF00923.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;