Protein coding transcript 138798

• Transcript: Ll_transcript_3556
• CDS coordinates: 53-586 (+)
• Peptide sequence: MRTMTLFCLSSNLSPLPKLNPSSSTKSLPSITVTTGRRTLVSSLVMPFLLNLATPLSFAHQILDQEDNLVQLFKETSPSVVFIKDLELSKVPKASSNEVMQLKEDEDAKVEGTGSGFIWDKYGHIVTNYHVVAKLATDTNGLQRCKVSLVDAKGNSFYRDGKIIGFDPAYDLAVLKV*
• ORF Type: complete

Annotations of Ll_transcript_3556

• Blastp: Protease Do-like 5, chloroplastic from Arabidopsis with 65.74% of identity
• Blastx: Protease Do-like 5, chloroplastic from Arabidopsis with 76.52% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT4G18370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418194.1)
• Pfam: Trypsin-like peptidase domain (PF13365.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;