Protein coding transcript 1388

• Transcript: Ll_transcript_324947
• CDS coordinates: 3-590 (+)
• Peptide sequence: SGEVRVTALDTDGGSFIDDLKEGDLWYFPSGHPHSLQGLGENGTEFLLVFDSGDFSEDSTFLLNEWIEHTPKAVVAENFRLPPEIFENIHEKDKYIFQGSIPKSIEEETPPAFKKSKHQYTHHMLDTPADEGSGGKARIVDSKNFPISKTIAAGHLDIEPGAMREMHWHPNADEWSFFIKGRARVTIFAAEGNART
• ORF Type: internal

Annotations of Ll_transcript_324947

• Blastp: Oxalate decarboxylase OxdD from Bacillus with 50.51% of identity
• Blastx: Oxalate decarboxylase OxdD from Bacillus with 50.51% of identity
• Eggnog: Oxalate decarboxylase(COG2140)
• Kegg: Link to kegg annotations (BSU18670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444752.1)
• Pfam: Cupin (PF00190.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;