Transcript | Ll_transcript_323876 |
---|---|
CDS coordinates | 38-658 (+) |
Peptide sequence | MDKRQCNSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQAENFQQQSSSHQTNDCHHHHQESTSQMSTTMAHHEPVGTTYSPPSYQGSTLNPIFPTQFSTTIPDQSSCCPTNDNTYWSMEDIWTI* |
ORF Type | complete |
Blastp | Myb-related protein 305 from Antirrhinum with 65.6% of identity |
---|---|
Blastx | Myb-related protein 305 from Antirrhinum with 65.18% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451626.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer