Protein coding transcript 138887

• Transcript: Ll_transcript_3494
• CDS coordinates: 1-606 (+)
• Peptide sequence: SKSPQKILASAFSEFLPKSDVEMVPASTNTHTTLLGEQSLVAPSTDASNPPAPSPDATTDSYFQGLALIKTLVKLIPGWFHNNRIVFDTLVLVWKSPARISRLQNEQELNLVQVKESKWLVKCFLNYLRHDQNEVHVLFDILTIFLYHSRIDYTFLKEFYIIEVAEGYPPGMKKSLLLHFLNLFQSKQLDHDHIVIVMQMLI
• ORF Type: internal

Annotations of Ll_transcript_3494

• Blastp: Probable transcription-associated protein 1 from Dictyostelium with 28.67% of identity
• Blastx: Probable transcription-associated protein 1 from Dictyostelium with 27.66% of identity
• Eggnog: phosphatidylinositol kinase activity(COG5032)
• Kegg: Link to kegg annotations (DDB_G0281947)
• CantataDB: Link to cantataDB annotations (CNT0000204)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423288.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;