Protein coding transcript 138924

• Transcript: Ll_transcript_3472
• CDS coordinates: 42-1109 (+)
• Peptide sequence: MADVVQYRLERMLDELDDLEQRGLFSRREIAEIVKQRRKFEYRLKRPCPLKQDFLAYIEYESQLDALRSLRMKSVAREMKKQGNTDLKKSKSDIAGLRRIMDIYEIALKRFKGDLQLWFQYLEFCRNKKNGRMKKGLAKVIRFHPKVPGVWIYAAAWEFDHNLNVTAARALMQEGLRVCPTSEELWVEYLRMELTYINKLKARKVALGEDEGTLTRDPKTAVEKQWRDENKELFRPLGEKASNDGPDVESEEPNKKKELFEEHGMNIFRTVYGAAVEAIPLSLSLRKCFFEILEGTNLAHFEDVRKEILGDMKRDFSTEPEFWDWLARHECDLENVPVDISEEVITSKVDKAIQV*
• ORF Type: complete

Annotations of Ll_transcript_3472

• Blastp: U3 small nucleolar RNA-associated protein 6 homolog from Homo with 29.69% of identity
• Blastx: U3 small nucleolar RNA-associated protein 6 homolog from Homo with 29.69% of identity
• Eggnog: UTP6, small subunit (SSU) processome component, homolog (yeast)(COG5191)
• Kegg: Link to kegg annotations (55813)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464069.1)
• Pfam: U3 small nucleolar RNA-associated protein 6 (PF08640.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;