Protein coding transcript 138978

• Transcript: Ll_transcript_240110
• CDS coordinates: 497-856 (+)
• Peptide sequence: MGLICISLFGAQWLIGFLNFWHRGEVRKARIRILPWHVFLGLYTYALAIATAETGLLEKLTFIQTNRNVSKHSTESIVVNSLGLGLALLSGFVILAAVSPKYQTLQTKVLYSETRCLSS*
• ORF Type: complete

Annotations of Ll_transcript_240110

• Blastp: Probable transmembrane ascorbate ferrireductase 4 from Arabidopsis with 64.52% of identity
• Blastx: Probable transmembrane ascorbate ferrireductase 4 from Arabidopsis with 55.88% of identity
• Eggnog: Cytochrome(ENOG4111FKI)
• Kegg: Link to kegg annotations (AT1G26100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454620.1)
• Pfam: Eukaryotic cytochrome b561 (PF03188.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;