Protein coding transcript 13899

• Transcript: Ll_transcript_323755
• CDS coordinates: 3-626 (+)
• Peptide sequence: RIVILNCSTNHMFSIFLLFSFFLTFEYCSARDTITINNSLKDEGVNTIISAGENFELGFFTPNGSSISRRYVGIWYYKLNPQTVVWVANRNNPLRDSGGAFAVAEDGNLRVLDKSGKSYWGTNLERSSSLHRTVKLLDNGNLIVCNEDQESHSVKILWQSFANPTDTFLPGMKMDETIALTSWTSNEDPAPGNFSFVQDQGEKNQYII
• ORF Type: internal

Annotations of Ll_transcript_323755

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 from Arabidopsis with 50% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 from Arabidopsis with 51.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G03230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451094.1)
• Pfam: D-mannose binding lectin (PF01453.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;