Protein coding transcript 139093

• Transcript: Ll_transcript_240084
• CDS coordinates: 197-646 (-)
• Peptide sequence: MVQDLACDPNSHPRFQFQTGRLLYKERLVLSKSSNKLPLILAECHDSVARGHSGIFRTYNKVSSFFYWEGMRSYVKQYVEACDVCQRQKYSTLAPGGLLQPLPIPTQVWQDISMDFISGLPKSKDKDTIYMVVDRLIYSLLPTESSFHC*
• ORF Type: complete

Annotations of Ll_transcript_240084

• Blastp: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 31.54% of identity
• Blastx: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 27.24% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC167.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015964281.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;