Transcript | Ll_transcript_240086 |
---|---|
CDS coordinates | 125-643 (+) |
Peptide sequence | MTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLKNKVELTTAAIVANCFVFLIGYKVFRGANKQKHDFKKNPKAPIWGKPPKVIGGKLLASGYWGVARHCNYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAQYRKLVPWRILPYVY* |
ORF Type | complete |
Blastp | Delta(14)-sterol reductase from Arabidopsis with 90.12% of identity |
---|---|
Blastx | Delta(14)-sterol reductase from Arabidopsis with 89.84% of identity |
Eggnog | )-reductase(ENOG410XP67) |
Kegg | Link to kegg annotations (AT3G52940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428896.1) |
Pfam | Ergosterol biosynthesis ERG4/ERG24 family (PF01222.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer