Protein coding transcript 1391

• Transcript: Ll_transcript_324999
• CDS coordinates: 50-628 (+)
• Peptide sequence: MSKMSFLKFQYNFSGKPSSPNKNLSQKNNFKSSSTSSAGKESSFQPKIEEMKWVFEKFDTNKDSKISLEEYKAASRALDRSIGETEAAKAFKFMDTDGDGFINFKEFMEMFNGENKDGKVKETEIKNAFKVFDLNGDGKISAEELSHVLKRLGESCSIGACKKMVKGVDVNGDGFIDLNEFMRMMMSGKKLG*
• ORF Type: complete

Annotations of Ll_transcript_324999

• Blastp: Calmodulin-like protein 1 from Arabidopsis with 44.44% of identity
• Blastx: Calmodulin-like protein 1 from Arabidopsis with 48.25% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT2G15680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423154.1)
• Pfam: Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;