Protein coding transcript 139111

• Transcript: Ll_transcript_240281
• CDS coordinates: 223-1107 (+)
• Peptide sequence: MENQNRLKLRISRMFRSSFGSCRTRNFTDVMEKAVFSPPQNHSVTFHQLLMDPPSPKPRPFPSICKPKMSQTSQKTNDQCIMPFKDSLPRPKISEKCLPPFANNSRSYSLVSPNTPFDDNVFGFEETTKNSKRNIRSNKKKKKNNTQKRREIFPFNSCAKDTNFGDYYCFGSDEDDETDTLFSSKSISSDSSRSRRRRRKNNSGDRKKSQGSEMGVLPLHGKVKDTFAVVKRSSDPYNDFRTSMVEMIVEKQIFSPRDLENLLQCFLSLNLCRHHKIIVEVFTEIWEALFSDWL*
• ORF Type: complete

Annotations of Ll_transcript_240281

• Blastp: Transcription repressor OFP8 from Arabidopsis with 70.15% of identity
• Blastx: Transcription repressor OFP8 from Arabidopsis with 70.15% of identity
• Eggnog: Pfam:DUF623(ENOG410YX1Q)
• Kegg: Link to kegg annotations (AT5G19650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446327.1)
• Pfam: Transcriptional repressor, ovate (PF04844.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;