Protein coding transcript 139173

• Transcript: Ll_transcript_240330
• CDS coordinates: 3-302 (+)
• Peptide sequence: LLAEGSDSVAEAESAILESISSHVRAAVATLGGQHGASGRPDKWRHLYAGFTVWLSQTEATGSIFNPFLDLHCILSDKHMQPNLVLNLQIHSLLELKYG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_240330

• Blastp: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 77.05% of identity
• Blastx: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 77.27% of identity
• Eggnog: Shikimate kinase(ENOG410XSXA)
• Kegg: Link to kegg annotations (AT2G35500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421268.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;