Protein coding transcript 139174

• Transcript: Ll_transcript_240332
• CDS coordinates: 2-637 (+)
• Peptide sequence: IICIEMASTTSWAGLWFLTRNTTFSTTNTNTSLEFSVLKPNAGSFRLFSPYSLFHNGSTSLTQRSCKCSYSAPVSTRTYEFSDTSSEVELRLNLKGLDIKSSKEILVDTSDSSLAIRALRPGLPVTLIETNRLFDRIKPSETIWYIDDDELVVNFKKQDPDLKWPDIMESWESLTAGSAQLLKGASIYLVGNSTEINYKVAQEIATGLGYY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_240332

• Blastp: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 57.06% of identity
• Blastx: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 77.03% of identity
• Eggnog: Shikimate kinase(ENOG410XSXA)
• Kegg: Link to kegg annotations (AT2G35500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450710.1)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;