Protein coding transcript 139257

• Transcript: Ll_transcript_240401
• CDS coordinates: 1634-1954 (+)
• Peptide sequence: MYSHLCRCSDLLLALMISGYFKIFLIAMTVWEFPSSVIFIIELFCLSSNAVALKVMTESTMSRCVCACFSAYAIKLFATQILDLTFWGKLIQGWSQTPSSFSLKPS*
• ORF Type: complete

Annotations of Ll_transcript_240401

• Blastp: Protein arv1 homolog from Dictyostelium with 34.43% of identity
• Blastx: Protein arv1 from Schizosaccharomyces with 47.14% of identity
• Eggnog: ARV1 homolog (S. cerevisiae)(COG5254)
• Kegg: Link to kegg annotations (DDB_G0290221)
• CantataDB: Link to cantataDB annotations (CNT0001977)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454675.1)
• Pfam: Arv1-like family (PF04161.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;