Protein coding transcript 139272

• Transcript: Ll_transcript_232780
• CDS coordinates: 560-1810 (+)
• Peptide sequence: MVHTVQELYGSNVAGNLLSALSRLFTNFLQMHGFTCGVDDLLITEEKDGERMAQLESCEEIGDIVHREFVGVMDNARLDPITLQLNIEKKIRSNGEAALTYLDRKMISNLNTRTSSGILKELLSEGILKSSGKNWISLMTTSGAKGSMVNFQQISSHLGQQELEGKRVPRMVSGKTLPCFTPWDCSPRAGGFIIDRFLTALRPQEYYFHCMAGREGLVDTAVKTSRSGYLQRCLMKNLECLKVSYDHTVRDSDGSVIQFHYGEDGVDVHQTSFITKFEALSTNKELVNSNFCRQLDKSSPYINKLPDALERKAKKFIREKQRNTGSIKRSDFLKLMEHKYISSLAQPGEPVGVLASQSVGEPATQMTLNTFHLAGRGEMNVTLGIPRLQEILMAAARDIKTPFMSCPLTLIPEKSM*
• ORF Type: complete

Annotations of Ll_transcript_232780

• Blastp: DNA-directed RNA polymerase I subunit 1 from Arabidopsis with 65.7% of identity
• Blastx: DNA-directed RNA polymerase I subunit 1 from Arabidopsis with 63.78% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0086)
• Kegg: Link to kegg annotations (AT3G57660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421167.1)
• Pfam: RNA polymerase Rpb1, domain 3 (PF04983.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;