Protein coding transcript 139295

• Transcript: Ll_transcript_232796
• CDS coordinates: 32-1093 (+)
• Peptide sequence: MASLIDQSAIELLHGEAILHNQLFSFMRPMCLKWAVELGIADIIHNHAKPITFPELMLALVQVPPTKASLVKRFMRFLAHNGIFAIHESQEEEHETYSLTPASKLLVKGSDHCLTPFVLWAADPVRVNNYHHLGNWVCGEVPTLYETSLGMSIWEYLEKNPDYMSTFNEGMASDCKLLKLTLKDCSTVFEGLDTIVDVGGGNGTIAKIISELFPKLKIVVYDLPQVVANLQGSNNVSYVAGDMFVSIPQADAVLLKRILHDWTDETCIKILKKCKDSISSRNGKVIIIEALIDEKQDDKVLTETKLSMDIMMMTVNGKERNEKEWKELFVAAGFNHYKICHLHGLRSLIEVYP*
• ORF Type: complete

Annotations of Ll_transcript_232796

• Blastp: Isoflavone-7-O-methyltransferase 6 from Medicago with 53.93% of identity
• Blastx: Isoflavone-7-O-methyltransferase 6 from Medicago with 53.93% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAC49926)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451688.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;