Protein coding transcript 139330

• Transcript: Ll_transcript_232806
• CDS coordinates: 122-592 (+)
• Peptide sequence: MCRQSQRKMVLQRSMVQRVVEGITFLFELLVKFVLSVQKVDPHPENKDDGYGLSWRLAVETNNVRGWKTVPPKCYKHVEEYMTGGQYEVDLKLIVDQILGYASQISVSSDGFDAWILDVDDTCISNISYYKAMRFGSVFLCGYAFYTIMLIYMSRR*
• ORF Type: complete

Annotations of Ll_transcript_232806

• Blastp: Acid phosphatase 1 from Lycopersicon with 34.68% of identity
• Blastx: Acid phosphatase 1 from Lycopersicon with 34.68% of identity
• Eggnog: Acid phosphatase(ENOG410YBHH)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430439.1)
• Pfam: HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;