Transcript | Ll_transcript_323680 |
---|---|
CDS coordinates | 524-1099 (+) |
Peptide sequence | MITLRYFSDLLFIVVNIVAMGFANLIGGLFIIFHNLIELRNDHSGGDLQQTNFMQEDRYQAQLGRRANFLLHIVVAILSFLIFGSVPIIVYGLLIHKNYSGELKFAVVAVTSIICIILLAIGKVYTKSTPKSYTTTLLRYVTLALAASGVSYIAGGLIDNLLENFNDPKSGFVLTIPSTGTRSVKPAWVPY* |
ORF Type | complete |
Blastp | Membrane protein of ER body 1 from Arabidopsis with 40.12% of identity |
---|---|
Blastx | Membrane protein of ER body 1 from Arabidopsis with 39.31% of identity |
Eggnog | VIT family(ENOG41129ND) |
Kegg | Link to kegg annotations (AT4G27860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417207.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer