Protein coding transcript 13942

• Transcript: Ll_transcript_323680
• CDS coordinates: 524-1099 (+)
• Peptide sequence: MITLRYFSDLLFIVVNIVAMGFANLIGGLFIIFHNLIELRNDHSGGDLQQTNFMQEDRYQAQLGRRANFLLHIVVAILSFLIFGSVPIIVYGLLIHKNYSGELKFAVVAVTSIICIILLAIGKVYTKSTPKSYTTTLLRYVTLALAASGVSYIAGGLIDNLLENFNDPKSGFVLTIPSTGTRSVKPAWVPY*
• ORF Type: complete

Annotations of Ll_transcript_323680

• Blastp: Membrane protein of ER body 1 from Arabidopsis with 40.12% of identity
• Blastx: Membrane protein of ER body 1 from Arabidopsis with 39.31% of identity
• Eggnog: VIT family(ENOG41129ND)
• Kegg: Link to kegg annotations (AT4G27860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417207.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;