Protein coding transcript 139479

• Transcript: Ll_transcript_233128
• CDS coordinates: 206-592 (+)
• Peptide sequence: MLMRRCVYENTSKDDIPKLFPNEVLPELQKLLTLLLQKFQQEWQEELLKDQNIVPRLKAMTWNMGNQDKESSDPVAVINMKLQGDAQLHSREQDVKFQLATDTLDTVLKAMHCIRDQFSTTDETPNGH*
• ORF Type: complete

Annotations of Ll_transcript_233128

• Blastp: COMM domain-containing protein 9 from Bos with 32.06% of identity
• Blastx: Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 40.3% of identity
• Eggnog: HCaRG protein(ENOG4111H94)
• Kegg: Link to kegg annotations (510280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429261.1)
• Pfam: COMM domain (PF07258.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;