Transcript | Ll_transcript_233001 |
---|---|
CDS coordinates | 155-586 (-) |
Peptide sequence | MFFDAKEAVRFSCPPVLETILTLGEIEELFSLINESGDPESPSSGSQGSNRAVYSTQERKIRRMQSNRESARRSRWRKKQHVDNMRNQMNRLKAENRELKNRLGFTMHHNLLISIENESLRSESLALMTKLSDLIVILDTMLL* |
ORF Type | complete |
Blastp | bZIP transcription factor 44 from Arabidopsis with 40.82% of identity |
---|---|
Blastx | bZIP transcription factor 2 from Arabidopsis with 44.32% of identity |
Eggnog | Ocs element-binding factor(ENOG410ZM7Q) |
Kegg | Link to kegg annotations (AT1G75390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014632411.1) |
Pfam | Basic region leucine zipper (PF07716.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer