Protein coding transcript 1396

• Transcript: Ll_transcript_325006
• CDS coordinates: 221-562 (+)
• Peptide sequence: MATSSSFTFLFICATLLVAITAVQGMGLEWVPTTVKPPCKGSIAECMEEGEEFELDSEINRRILATTSYISYGALQRNTVPCSRRGASYYNCKTGAQANPYNRGCSAITRCRS*
• ORF Type: complete

Annotations of Ll_transcript_325006

• Blastp: -
• Blastx: Protein RALF-like 33 from Arabidopsis with 68.69% of identity
• Eggnog: Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2 ) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity)(ENOG410Z3VJ)
• Kegg: Link to kegg annotations (AT4G15800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441167.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;