Protein coding transcript 1397

• Transcript: Ll_transcript_324985
• CDS coordinates: 41-1033 (+)
• Peptide sequence: MEFSISSYITITITILLLMKCFTVNSIISTTEFDSMLDTLRVRGYNLFCNAILTSDLQFDLQDSNLNNSFTFFAPTDSSLFALDMTQTASSYTDTLRLHVIPRRLSLPQLRLLRDGYTLPTLLQDRHVSITRRDASVISVAGVDVLFPGLFYGRDVAVHGLAGILRLRSNVVDEGSGSSHSSSPSPAPVLPPVRSAPRTSPQSHSPVPTPVPKFVSFNVTRRRGSAHSPVASPAPSPFATRREPAAPSPANSIVHAPVVSPVPVNISIIHAPEAETNRRFDPPAISPSRFPDSKISSPPVGLKSEALDRKRKCASSEENIGHMQCYAGTG*
• ORF Type: complete

Annotations of Ll_transcript_324985

• Blastp: Fasciclin-like arabinogalactan protein 19 from Arabidopsis with 41.97% of identity
• Blastx: Fasciclin-like arabinogalactan protein 19 from Arabidopsis with 50.72% of identity
• Eggnog: FAS1(ENOG41118BZ)
• Kegg: Link to kegg annotations (AT1G15190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440392.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;