Protein coding transcript 139728

• Transcript: Ll_transcript_82247
• CDS coordinates: 25-309 (+)
• Peptide sequence: MADTTKKPVKTVKGLPVVPETILARRKRRDQHALSRHKTALALRAKRVATRKVIFKRAEMYQREYIKRERDEIRVRRNATKKGDYYVPSEAKLAF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_82247

• Blastp: 60S ribosomal protein L7-3 from Arabidopsis with 46.84% of identity
• Blastx: 60S ribosomal protein L7-3 from Arabidopsis with 46.84% of identity
• Eggnog: ribosomal large subunit biogenesis(COG1841)
• Kegg: Link to kegg annotations (AT2G44120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014489822.1)
• Pfam: Ribosomal L30 N-terminal domain (PF08079.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;