Protein coding transcript 139731

• Transcript: Ll_transcript_82250
• CDS coordinates: 1-492 (+)
• Peptide sequence: VPSDARLAFVIRIRGVNKVAPKVRKVLQLFRLKQINNGVFVSLNKATVNMLRICEPYITWGYPNLKSIRELVYKRGFAKVNHQRIPITSNEIIENALKNKDIICVEDLVHEIFTVGKKFKYASNFLWPFKLNTPTGGWRRKNNHYVEGGDFGNREDKINELLRR
• ORF Type: internal

Annotations of Ll_transcript_82250

• Blastp: 60S ribosomal protein L7 from Sophophora with 78.79% of identity
• Blastx: 60S ribosomal protein L7 from Sophophora with 78.79% of identity
• Eggnog: ribosomal large subunit biogenesis(COG1841)
• Kegg: Link to kegg annotations (Dmel_CG4897)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235662.1)
• Pfam: Ribosomal protein L30p/L7e (PF00327.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;