Transcript | Ll_transcript_82355 |
---|---|
CDS coordinates | 168-683 (+) |
Peptide sequence | MKLFNINGTSLSVALYTDVTNSKELLESMQAGTLEPEVAFLNASLVPDIFPVLAAAHKTLVAKSRDSLTTRTIHSELVYNYSGSKHITESLKRCGISDSTTYILAARFDATPDAIEGIGKLINGKEIDLEELEGRANRPQIQKHYKISAPELGVSSLADAITCRIAARDVL* |
ORF Type | complete |
Blastp | EKC/KEOPS complex subunit TPRKB from Homo with 30.67% of identity |
---|---|
Blastx | EKC/KEOPS complex subunit TPRKB from Homo with 30.67% of identity |
Eggnog | Tp53rk binding protein(ENOG4111MCN) |
Kegg | Link to kegg annotations (51002) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443921.1) |
Pfam | Kinase binding protein CGI-121 (PF08617.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer