Protein coding transcript 139844

• Transcript: Ll_transcript_82360
• CDS coordinates: 79-729 (+)
• Peptide sequence: MFVPFHVVSVSNVRSVLPICRVILHIFVAAYLCNKSRLRRLKVEAMKLFNINGTSLSVALYTDVTNSKELLESMQAGTLEPEVAFLNASLVPDIFPVLAAAHKTLVAKSRDSLTTRTIHSELVYNYSGSKHITESLKRCGISDSTTYILAARFDATPDAIEGIGKLINGKEIDLEELEGRANRPQIQKHYKISAPELGVSSLADAITCRIAARDVL*
• ORF Type: complete

Annotations of Ll_transcript_82360

• Blastp: EKC/KEOPS complex subunit TPRKB from Homo with 30.67% of identity
• Blastx: EKC/KEOPS complex subunit TPRKB from Homo with 30.67% of identity
• Eggnog: Tp53rk binding protein(ENOG4111MCN)
• Kegg: Link to kegg annotations (51002)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443921.1)
• Pfam: Kinase binding protein CGI-121 (PF08617.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;