Protein coding transcript 13990

• Transcript: Ll_transcript_323609
• CDS coordinates: 328-984 (+)
• Peptide sequence: MNCLPCFSSQKSKKSNSKREHGTTPPENVMAKAPDLKKPRPADPNQVFDPANINAQNYTFRELATATKNFRQECMMGEEGFGRVYKGIIPATGKVVAVKQLDRNAMQGCKDFLAEVWALSLLHHENLVDLIGYCADGDQRLLVYEFLPGGSLEQCLFESREDEPPLDWYSRMKVASSAAKGLWYLHDKANPPVIYRDLKSSNILLDNEFNAKLSDYGLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_323609

• Blastp: Probable serine/threonine-protein kinase PBL26 from Arabidopsis with 57.02% of identity
• Blastx: Probable serine/threonine-protein kinase PBL26 from Arabidopsis with 57.39% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G07070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426851.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;