Protein coding transcript 139974

• Transcript: Ll_transcript_151816
• CDS coordinates: 40-399 (+)
• Peptide sequence: MALLSAVKAGIFVVQAAGNTGPSPMSMSSFSPWIFTVGAASHDRTYSNSIFLGNNVTIPGVGLASGTDENKTYKLIHAHHALNNDTTVSDDVYVGECQDANKFNKDLVQGNLLICSYSIR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_151816

• Blastp: Subtilisin-like protease SBT2.2 from Arabidopsis with 76.86% of identity
• Blastx: Subtilisin-like protease SBT2.2 from Arabidopsis with 77.61% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT4G20430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415781.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;