Transcript | Ll_transcript_151737 |
---|---|
CDS coordinates | 1804-2229 (+) |
Peptide sequence | MLKRKALELNVNEQVEFHKNITYRELVRLLGGAVAGIHSMTDEHFGISVVEYMAAGAIPIAHNSAGPKMDIVLAEDGEQTGFLAWNIDEYADAISRIIRMPEKERLLMASAARKRARRFSEQRFYDDFKAALRPILCHVSK* |
ORF Type | complete |
Blastp | GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase from Arabidopsis with 71.11% of identity |
---|---|
Blastx | GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase from Arabidopsis with 71.64% of identity |
Eggnog | Glycosyl transferase (Group 1(COG0438) |
Kegg | Link to kegg annotations (AT2G40190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429075.1) |
Pfam | Glycosyl transferases group 1 (PF00534.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer