Transcript | Ll_transcript_151512 |
---|---|
CDS coordinates | 187-573 (+) |
Peptide sequence | MYSESFFKGFRKWYHKTLSLLVQIIFMATNCGASKRKASDEIDYVNFSIRGQDGSLLFYKVNNDTEFKHVFEDYCKKKRLEYATIQFLHEGQRVLGRQKPKKRNLEDGAEILAMKQVMGGGVATLIFY* |
ORF Type | complete |
Blastp | Small ubiquitin-related modifier 2 from Arabidopsis with 33.72% of identity |
---|---|
Blastx | Small ubiquitin-related modifier 2 from Arabidopsis with 33.72% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G55160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460654.1) |
Pfam | Ubiquitin-2 like Rad60 SUMO-like (PF11976.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer