Transcript | Ll_transcript_151437 |
---|---|
CDS coordinates | 63-602 (+) |
Peptide sequence | MLMSVCSFSRYKYDFPFLETKGIVTVDDNRVGPLYRHVFPPELAPWLSFVGLPWMVAPFSVFERQSNWIAGTLSNRIALPSKEKMMEDVQAFYSSLEASGTPKRYTHKMADLQWDYDNWVSDQCGFPAIEEWRVQMYDATSKNRVLRAESYRDVWDDDDLADQAQKDFANYLIRQVPKL* |
ORF Type | complete |
Blastp | Flavin-containing monooxygenase FMO GS-OX-like 5 from Arabidopsis with 59.63% of identity |
---|---|
Blastx | Flavin-containing monooxygenase FMO GS-OX-like 5 from Arabidopsis with 61.27% of identity |
Eggnog | Monooxygenase(COG2072) |
Kegg | Link to kegg annotations (AT1G63370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424299.1) |
Pfam | Flavin-binding monooxygenase-like (PF00743.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer