Protein coding transcript 140151

• Transcript: Ll_transcript_151443
• CDS coordinates: 2267-2752 (+)
• Peptide sequence: MWLHSTIESVHGSTVVFQHGKAVSADFIVHCTGYKYDFPFLETKGIVTVDDNRVGPLYRHVFPPELAPWLSFVGLPWMVAPFSVFERQSNWIAGTLSNRIALPSKEKMMEDVQAFYSSLEASGTPKRYTHKMADLQVRAYLVSVYLNSKSLRFILCPQKDT*
• ORF Type: complete

Annotations of Ll_transcript_151443

• Blastp: Flavin-containing monooxygenase FMO GS-OX-like 3 from Arabidopsis with 65.25% of identity
• Blastx: Flavin-containing monooxygenase FMO GS-OX-like 2 from Arabidopsis with 50.19% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT1G62620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424299.1)
• Pfam: Flavin-binding monooxygenase-like (PF00743.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;