Protein coding transcript 140153

• Transcript: Ll_transcript_151447
• CDS coordinates: 2267-2875 (+)
• Peptide sequence: MWLHSTIESVHGSTVVFQHGKAVSADFIVHCTGYKYDFPFLETKGIVTVDDNRVGPLYRHVFPPELAPWLSFVGLPWMVAPFSVFERQSNWIAGTLSNRIALPSKEKMMEDVQAFYSSLEASGTPKRYTHKMADLQWDYDNWVSDQCGFPAIEEWRVQMYDATSKNRVLRAESYRDVWDDDDLADQAQKDFANYLIRQVPKL*
• ORF Type: complete

Annotations of Ll_transcript_151447

• Blastp: Flavin-containing monooxygenase FMO GS-OX-like 5 from Arabidopsis with 59.49% of identity
• Blastx: Flavin-containing monooxygenase FMO GS-OX-like 5 from Arabidopsis with 58.56% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT1G63370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424299.1)
• Pfam: Flavin-binding monooxygenase-like (PF00743.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;