Transcript | Ll_transcript_324006 |
---|---|
CDS coordinates | 132-842 (+) |
Peptide sequence | MEIEQENGHHHHHDAEIENEKEGINGCLSSFTDDGSIESHRYYLSRRTALEMLKDRGYSVPSSEIDISLSEFRTIHGQSPDVDRLRFSATHNSDPSKRILVIFCGPGVVKVNVIRNIAGQIVNRETLTGLILIVQDQITAQALKAVKIFSFKVEIFQITDLLVNITKHVLKPKHEVLTERQKQNLLKKYNLEEKQLPRMLQTDAITKYYGLERGQVVKVTYNGEVTQLHVTYRCVW* |
ORF Type | complete |
Blastp | DNA-directed RNA polymerase V subunit 5A from Arabidopsis with 60.48% of identity |
---|---|
Blastx | DNA-directed RNA polymerase V subunit 5A from Arabidopsis with 59.9% of identity |
Eggnog | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates(COG2012) |
Kegg | Link to kegg annotations (AT3G57080) |
CantataDB | Link to cantataDB annotations (CNT0001929) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458973.1) |
Pfam | RNA polymerase Rpb5, N-terminal domain (PF03871.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer